PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Psi009865

Organism

Picea sitchensis

Taxonomic ID

3332

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

NAC

Protein Properties

Length: 159aa MW: 18425.3 Da PI: 10.461

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Psi#S38769478	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	168.5	2.2e-52	14	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 +p GfrF+Ptdeel+ +yLkkkv++++l++ ++i+e+d+yk++PwdLp+k+ +ekewyfFs rd+ky++ r+nr++ sgyWkatg+dk+++ +++++v Psi009865 14 VPIGFRFDPTDEELLIHYLKKKVSSSPLPA-SIIAEIDLYKHDPWDLPAKAFFGEKEWYFFSLRDRKYPNRARPNRSAGSGYWKATGTDKPIVISSSQKV 112 589*************************.89***********8777899***************************************** PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kk+Lvfykgr kg kt+W+mheyrl Psi009865 113 GVKKSLVFYKGRPLKGIKTNWIMHEYRL 140 ************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.35E-57	9	145	IPR003441	NAC domain
PROSITE profile	PS51005	52.581	14	159	IPR003441	NAC domain
Pfam	PF02365	8.6E-27	15	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MEGLEFHQQV LPQVPIGFRF DPTDEELLIH YLKKKVSSSP LPASIIAEID LYKHDPWDLP 60 AKAFFGEKEW YFFSLRDRKY PNRARPNRSA GSGYWKATGT DKPIVISSSQ KVGVKKSLVF 120 YKGRPLKGIK TNWIMHEYRL AETLPTKRKG SIRVRIPYS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	2e-61	14	154	20	157	NAC domain-containing protein 19
3swm_B	2e-61	14	154	20	157	NAC domain-containing protein 19
3swm_C	2e-61	14	154	20	157	NAC domain-containing protein 19
3swm_D	2e-61	14	154	20	157	NAC domain-containing protein 19
3swp_A	2e-61	14	154	20	157	NAC domain-containing protein 19
3swp_B	2e-61	14	154	20	157	NAC domain-containing protein 19
3swp_C	2e-61	14	154	20	157	NAC domain-containing protein 19
3swp_D	2e-61	14	154	20	157	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Psi.12314	0.0	needle

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269\|PubMed:22278768}.
Uniprot	TISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:22278768}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269\|PubMed:22278768}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269\|PubMed:18813954}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019453752.1	5e-73	PREDICTED: NAC transcription factor 56-like
Refseq	XP_021992824.1	3e-73	NAC transcription factor 25-like
Refseq	XP_024967722.1	4e-73	NAC transcription factor 56-like
Swissprot	Q8H4S4	7e-70	NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBL	D5ABS0	2e-94	D5ABS0_PICSI; Uncharacterized protein
STRING	XP_007149615.1	7e-71	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G61110.1	4e-72	NAC domain containing protein 25

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]