| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 29.1 | 1.6e-09 | 399 | 431 | 23 | 55 |
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRake 55
+yps++++ LA+++gL+++q+ +WF N+R ++
Pta001304 399 PYPSESQKIALAESTGLDQKQINNWFINQRKRH 431
8*****************************885 PP
|
| 2 | ELK | 40.3 | 6.5e-14 | 351 | 372 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK+qLlrKYsgyL+sLkqEF+
Pta001304 351 ELKDQLLRKYSGYLSSLKQEFL 372
9********************8 PP
|
| Publications
? help Back to Top |
- Guillet-Claude C,Isabel N,Pelgas B,Bousquet J
The evolutionary implications of knox-I gene duplications in conifers: correlated evidence from phylogeny, gene mapping, and analysis of functional divergence. Mol. Biol. Evol., 2004. 21(12): p. 2232-45 [PMID:15317878] - dela Paz JS, et al.
Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events. PLoS Genet., 2012. 8(12): p. e1003136 [PMID:23284301] - Liu C, et al.
Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] - Liu B, et al.
NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(17): p. 5345-57 [PMID:23963677] - Simonini S,Kater MM
Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] - Scofield S,Dewitte W,Murray JA
STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] - Lee JE,Lampugnani ER,Bacic A,Golz JF
SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] - Rast-Somssich MI, et al.
Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] - Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering. Gene, 2016. 587(2): p. 120-31 [PMID:27154816] - Li Z, et al.
Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] - Lozano-Sotomayor P, et al.
Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] - Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
Nonreciprocal complementation of KNOX gene function in land plants. New Phytol., 2017. 216(2): p. 591-604 [PMID:27886385] - Woerlen N, et al.
Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root. Planta, 2017. 245(6): p. 1079-1090 [PMID:28204875] - Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] - Wang X, et al.
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana. Sci China Life Sci, 2018. 61(1): p. 79-87 [PMID:28887625] - Simonini S,Stephenson P,Østergaard L
A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] - Felipo-Benavent A, et al.
Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856]
|