![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pta005960 | ||||||||||||
| Organism | |||||||||||||
| Taxonomic ID | |||||||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||||||
| Family | WRKY | ||||||||||||
| Protein Properties | Length: 141aa MW: 15664.1 Da PI: 9.6719 | ||||||||||||
| Description | WRKY family protein | ||||||||||||
| Gene Model |
|
||||||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 108 | 4.8e-34 | 2 | 59 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dg++WrKYGqK+vkg+++prsYY+Cts +C v+k+ver+++dpk+v++tYeg+Hnh+
Pta005960 2 EDGFRWRKYGQKVVKGNPYPRSYYKCTSLKCAVRKHVERASDDPKAVITTYEGKHNHD 59
7********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 34.371 | 1 | 61 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.0E-38 | 1 | 60 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.1E-26 | 2 | 59 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 3.8E-32 | 2 | 61 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 8.76E-28 | 2 | 61 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
XEDGFRWRKY GQKVVKGNPY PRSYYKCTSL KCAVRKHVER ASDDPKAVIT TYEGKHNHDP 60 PLARNSNQDA AGISSPGLSG NGANAAQDKQ IQNRLTSFAK VSQGAAEGED KMHAGEVRGV 120 KLMRNNRQSD VEDIEREGSW Q |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 9e-34 | 2 | 61 | 18 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 9e-34 | 2 | 61 | 18 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pta.1081 | 0.0 | xylem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008369812.1 | 5e-35 | WRKY transcription factor 44-like | ||||
| Refseq | XP_008369813.1 | 5e-35 | WRKY transcription factor 44-like | ||||
| Refseq | XP_009338560.1 | 4e-35 | PREDICTED: WRKY transcription factor 44-like | ||||
| Refseq | XP_017187099.1 | 5e-35 | WRKY transcription factor 44-like | ||||
| Refseq | XP_018498928.1 | 4e-35 | PREDICTED: WRKY transcription factor 44-like | ||||
| Refseq | XP_019262739.1 | 6e-35 | PREDICTED: probable WRKY transcription factor 4 | ||||
| Refseq | XP_021826404.1 | 5e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_021826405.1 | 5e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_028956973.1 | 5e-35 | WRKY transcription factor 44-like | ||||
| Swissprot | Q9ZQ70 | 4e-33 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | B8LKI1 | 2e-85 | B8LKI1_PICSI; Uncharacterized protein | ||||
| STRING | Traes_5AS_9C6171380.1 | 3e-35 | (Triticum aestivum) | ||||
| STRING | TRIUR3_21018-P1 | 3e-35 | (Triticum urartu) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




