PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pta012468

Organism

Pinus taeda

Taxonomic ID

3352

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus

Family

MYB_related

Protein Properties

Length: 151aa MW: 16496.5 Da PI: 10.5198

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Pinus_taeda-31654	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43	1e-13	99	143	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ ++ + ++lG+g+W+ I+r + +Rt+ q+ s+ qky Pta012468 99 PWTEEEHRMFLIGLQKLGKGDWRGISRNFVPTRTPTQVASHAQKY 143 8***************************9***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50158	9.175	3	20	IPR001878	Zinc finger, CCHC-type
PROSITE profile	PS51294	19.478	92	148	IPR017930	Myb domain
SuperFamily	SSF46689	8.61E-19	94	149	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-18	95	147	IPR006447	Myb domain, plants
SMART	SM00717	4.5E-10	96	146	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.7E-13	96	142	IPR009057	Homeodomain-like
CDD	cd00167	1.06E-10	99	144	No hit	No description
Pfam	PF00249	2.9E-11	99	143	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 151 aa Download sequence Send to blast
MTRKCSHCGH NGHNSRTCPN RGVKLFGVRL TDGPIRKSVS MGNLLHYSNN ASSSNNSPAS 60 ASAMEPCESV ANAAASADGY VSDGLVHNNS RGERKKGVPW TEEEHRMFLI GLQKLGKGDW 120 RGISRNFVPT RTPTQVASHA QKYFIRQSNL T

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269\|PubMed:12172034}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002990122.2	1e-70	transcription factor MYBS3 isoform X1
Refseq	XP_024519624.1	9e-71	transcription factor MYBS3 isoform X2
Swissprot	Q7XC57	3e-69	MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBL	B8LRD4	1e-106	B8LRD4_PICSI; Uncharacterized protein
STRING	EFJ08839	2e-71	(Selaginella moellendorffii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47390.1	7e-66	MYB_related family protein

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Su CF, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol., 2010. 153(1): p. 145-58 [PMID:20130099]