PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pta012877

Organism

Pinus taeda

Taxonomic ID

3352

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus

Family

MYB_related

Protein Properties

Length: 125aa MW: 14674.3 Da PI: 4.4321

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Pinus_taeda-22322	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	22.8	2.2e-07	22	53	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT eEd +l +++++G g+W+ ar g Pta012877 22 KGPWTVEEDMQLTGYIRLHGEGRWSFLARAAG 53 79***********************9999877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.5E-11	16	74	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.911	17	70	IPR017877	Myb-like domain
SuperFamily	SSF46689	4.06E-14	23	97	IPR009057	Homeodomain-like
CDD	cd00167	0.00114	24	50	No hit	No description
Pfam	PF13921	3.8E-6	25	85	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.9E-6	75	96	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 125 aa Download sequence Send to blast
MENITSWGAS DIEDEEQAET RKGPWTVEED MQLTGYIRLH GEGRWSFLAR AAGMTQENWQ 60 ELQAKVLNSL RPDLKRSKIT PEEEHLIIEL HGRWGNSEQD LDKERQYFKM SCVYSDIIPD 120 CFWPT

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pta.16419	7e-48	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269\|PubMed:22301384}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026449677.1	2e-26	myb-related protein 305-like
Swissprot	Q10MB4	7e-24	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A0C9RMW5	6e-26	A0A0C9RMW5_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_9986_1363 transcribed RNA sequence
TrEMBL	A0A0D6QR05	9e-26	A0A0D6QR05_ARACU; Uncharacterized protein
STRING	XP_008780184.1	6e-25	(Phoenix dactylifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G25340.1	4e-26	myb domain protein 116

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]