PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC10899_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

WRKY

Protein Properties

Length: 150aa MW: 17361.2 Da PI: 5.3762

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC10899_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.5	2.8e-33	85	142	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dg++WrKYGqK+vkg+++prsYY+Ct++gC v+k+versaed+++v +tYeg+Hnh+ RrC10899_p1 85 VDGFRWRKYGQKVVKGNTNPRSYYKCTYQGCGVRKQVERSAEDERAVLTTYEGRHNHD 142 5********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	7.3E-35	69	144	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-29	76	144	IPR003657	WRKY domain
PROSITE profile	PS50811	34.107	79	144	IPR003657	WRKY domain
SMART	SM00774	3.5E-37	84	143	IPR003657	WRKY domain
Pfam	PF03106	3.2E-26	86	142	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MFNPSSIVSE THDQSENSSI SFDYSDLEQK SFKSEYGEIQ EEEEQPEIKR LKREGEDEGM 60 YAQVSRAVKE PKVVVQTISD IDVLVDGFRW RKYGQKVVKG NTNPRSYYKC TYQGCGVRKQ 120 VERSAEDERA VLTTYEGRHN HDIPTALRRS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-35	75	144	8	77	Probable WRKY transcription factor 4
2lex_A	2e-35	75	144	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250\|UniProtKB:Q9SI37, ECO:0000269\|PubMed:18839316, ECO:0000269\|PubMed:19125253, ECO:0000269\|PubMed:21336597}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269\|PubMed:18839316, ECO:0000269\|PubMed:19125253}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM593166	0.0	KM593166.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY140) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006295580.1	3e-96	probable WRKY transcription factor 25
Swissprot	O22921	3e-85	WRK25_ARATH; Probable WRKY transcription factor 25
TrEMBL	R0HWQ3	6e-95	R0HWQ3_9BRAS; Uncharacterized protein
STRING	XP_006295580.1	1e-95	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM11603	17	33

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30250.1	4e-87	WRKY DNA-binding protein 25

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]