![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC11093_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 104aa MW: 11737.3 Da PI: 9.7929 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.8 | 1.7e-19 | 16 | 50 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
RrC11093_p1 16 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 50
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 8.9E-17 | 10 | 64 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.76E-15 | 10 | 72 | No hit | No description |
| PROSITE profile | PS50114 | 12.215 | 10 | 46 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 7.5E-16 | 14 | 48 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.09E-13 | 15 | 63 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 16 | 41 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.9E-17 | 16 | 50 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
FSGQLLEEHQ QPSRRCSHCG VQKTPQWRAG PMGAKTLCNA CGVRYKSGRL LPEYRPACSP 60 TFSSELHSNH HRKVMEMRRK KEPADDKETG LNQLVQSSQA VPSF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189225 | 1e-117 | AC189225.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB011P07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018452766.1 | 1e-70 | PREDICTED: GATA transcription factor 5-like | ||||
| Refseq | XP_018452767.1 | 1e-70 | PREDICTED: GATA transcription factor 5-like | ||||
| Swissprot | Q9FH57 | 1e-61 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | A0A0D3E2Q2 | 3e-62 | A0A0D3E2Q2_BRAOL; GATA transcription factor | ||||
| TrEMBL | A0A3N6RUQ9 | 4e-63 | A0A3N6RUQ9_BRACR; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A3P6E359 | 6e-62 | A0A3P6E359_BRAOL; Uncharacterized protein | ||||
| STRING | Bo9g022010.1 | 6e-63 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3698 | 25 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66320.2 | 5e-64 | GATA transcription factor 5 | ||||




