![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC14814_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 79aa MW: 8416.75 Da PI: 7.6255 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 25.7 | 2.4e-08 | 4 | 36 | 4 | 36 |
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
+ C+ +++ + l+C+ + +lC +C ++ H
RrC14814_p1 4 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 36
68***************************9954 PP
| |||||||
| 2 | zf-B_box | 24.1 | 7.5e-08 | 46 | 78 | 3 | 35 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
++C+ +e+ +++ C+ + lC +C +H+
RrC14814_p1 46 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHS 78
689**************************9994 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00336 | 4.2E-13 | 1 | 48 | IPR000315 | B-box-type zinc finger |
| PROSITE profile | PS50119 | 10.438 | 1 | 48 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 1.6E-6 | 4 | 43 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 3.99E-5 | 5 | 48 | No hit | No description |
| PROSITE profile | PS50119 | 9.471 | 44 | 79 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 9.0E-6 | 46 | 78 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 3.76E-5 | 47 | 79 | No hit | No description |
| SMART | SM00336 | 0.42 | 49 | 79 | IPR000315 | B-box-type zinc finger |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005622 | Cellular Component | intracellular | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MASKLCDSCK SATAALYCRP DAAFLCLSCD SKVHAANKLA SRHARVWMCE VCEQAPAHVT 60 CKADAAALCV TCDRDIHSA |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KU949785 | 3e-58 | KU949785.1 Raphanus sativus var. raphanistroides isolate Rs-1 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949786 | 3e-58 | KU949786.1 Raphanus sativus var. raphanistroides isolate Rs-2 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949787 | 3e-58 | KU949787.1 Raphanus sativus var. raphanistroides isolate Rs-3 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949788 | 3e-58 | KU949788.1 Raphanus sativus var. raphanistroides isolate Rs-4 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949789 | 3e-58 | KU949789.1 Raphanus sativus var. raphanistroides isolate Rs-5 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949790 | 3e-58 | KU949790.1 Raphanus sativus var. raphanistroides isolate Rs-6 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949791 | 3e-58 | KU949791.1 Raphanus sativus var. raphanistroides isolate Rs-7 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949792 | 3e-58 | KU949792.1 Raphanus sativus var. raphanistroides isolate Rs-8 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| GenBank | KU949797 | 3e-58 | KU949797.1 Raphanus sativus var. raphanistroides isolate Rs-13 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010454822.1 | 1e-49 | PREDICTED: zinc finger protein CONSTANS-LIKE 4-like | ||||
| Swissprot | Q940T9 | 1e-50 | COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4 | ||||
| TrEMBL | A0A078G396 | 2e-48 | A0A078G396_BRANA; BnaA09g04740D protein | ||||
| STRING | Bo7g096320.1 | 4e-49 | (Brassica oleracea) | ||||
| STRING | Bostr.5763s0023.1.p | 4e-49 | (Boechera stricta) | ||||
| STRING | XP_006394745.1 | 4e-49 | (Eutrema salsugineum) | ||||
| STRING | XP_010454822.1 | 5e-49 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2760 | 27 | 65 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G24930.1 | 3e-52 | CONSTANS-like 4 | ||||




