![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC14979_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 121aa MW: 13893.4 Da PI: 8.6146 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 138.8 | 1.6e-43 | 31 | 108 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
+C+ve+C+ad+s+ak+yh+rhkvCevh+kapvv +sgl qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
RrC14979_p1 31 ACKVERCTADMSRAKQYHKRHKVCEVHAKAPVVWISGLGQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSTS 108
5**************************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 5.6E-56 | 1 | 118 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.4E-33 | 25 | 93 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.795 | 29 | 106 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.81E-39 | 31 | 108 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 8.3E-33 | 32 | 105 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MSEEEEEEEE EAWEKKQKGK ATSSSSSSIG ACKVERCTAD MSRAKQYHKR HKVCEVHAKA 60 PVVWISGLGQ RFCQQCSRFH ELSEFDEAKR SCRRRLAGHN ERRRKSTSEG ERSQNPGSQG 120 Y |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 7e-43 | 23 | 105 | 2 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape. {ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:16914499, ECO:0000269|PubMed:9301089}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ011633 | 1e-83 | AJ011633.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 3. | |||
| GenBank | AJ242959 | 1e-83 | AJ242959.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 3 (SPL3 gene). | |||
| GenBank | AK118179 | 1e-83 | AK118179.1 Arabidopsis thaliana At2g33810 mRNA for putative squamosa-promoter binding protein, complete cds, clone: RAFL19-50-A02. | |||
| GenBank | BT005443 | 1e-83 | BT005443.1 Arabidopsis thaliana clone U50647 putative squamosa-promoter binding protein (At2g33810) mRNA, complete cds. | |||
| GenBank | Y09427 | 1e-83 | Y09427.1 A.thaliana mRNA for squamosa-promoter binding protein like 3. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018437758.1 | 5e-71 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
| Swissprot | P93015 | 1e-51 | SPL3_ARATH; Squamosa promoter-binding-like protein 3 | ||||
| TrEMBL | M4CMN2 | 5e-57 | M4CMN2_BRARP; Squamosa promoter-binding-like protein | ||||
| STRING | Bra005470.1-P | 9e-58 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 2e-51 | squamosa promoter binding protein-like 3 | ||||




