PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC17277_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

ZF-HD

Protein Properties

Length: 60aa MW: 6820.62 Da PI: 9.0997

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC17277_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	58.4	1.7e-18	21	52	2	33
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpseg 33 ++vrY eC+kNhAa++Gg+avDGC+Efm+s++ RrC17277_p1 21 SNVRYVECQKNHAANIGGYAVDGCREFMASDT 52 689**************************954 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-11	1	50	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.4E-14	22	51	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	16.453	25	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 60 aa Download sequence Send to blast
MKKRQAVIKQ RKSSYTTSSS SNVRYVECQK NHAANIGGYA VDGCREFMAS DTYIYADLYD

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018438286.1	2e-29	PREDICTED: mini zinc finger protein 3-like
Swissprot	Q2Q493	5e-21	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	D7KH74	2e-24	D7KH74_ARALL; Uncharacterized protein
STRING	fgenesh2_kg.1__2061__AT1G18835.1	4e-25	(Arabidopsis lyrata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	1e-21	mini zinc finger