![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC17640_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 110aa MW: 12677.1 Da PI: 6.2514 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 38.7 | 2.1e-12 | 1 | 46 | 10 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ ++
RrC17640_p1 1 MVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASDS 46
579**********************************999998765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd14702 | 9.95E-15 | 1 | 44 | No hit | No description |
| PROSITE profile | PS50217 | 8.979 | 1 | 42 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.5E-11 | 1 | 46 | No hit | No description |
| Pfam | PF00170 | 4.0E-10 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 1.7E-5 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 7.0E-10 | 3 | 47 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MVSNRESARR SRMRKQRHLD ELLSQVAWLR SENQQLLDKL NQASDSNDLV IQENLSLKEE 60 NLELRQVIAS MKKLGGSTSI QGRYCSSSVD HELDQDFSCI TDDPRTYHPS |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 8 | 15 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC240087 | 1e-141 | AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013618656.1 | 7e-71 | PREDICTED: basic leucine zipper 43-like | ||||
| Refseq | XP_013659921.1 | 7e-71 | basic leucine zipper 43 | ||||
| Swissprot | Q9FMC2 | 1e-23 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A0D3AJ97 | 2e-69 | A0A0D3AJ97_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6DK54 | 2e-69 | A0A3P6DK54_BRAOL; Uncharacterized protein | ||||
| STRING | Bo2g012800.1 | 3e-70 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM10632 | 15 | 32 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15830.1 | 5e-51 | basic leucine-zipper 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




