![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC18144_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 79aa MW: 9303.94 Da PI: 9.8889 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 35.5 | 2.3e-11 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+WT eEd++l+d+++++G g+W+t ++
RrC18144_p1 14 KGPWTSEEDQKLLDYIQKHGYGNWRTLPKN 43
79************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-14 | 5 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 7.584 | 9 | 42 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 1.17E-10 | 11 | 45 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 9.3E-9 | 14 | 42 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MGRSPCCEKN GLKKGPWTSE EDQKLLDYIQ KHGYGNWRTL PKNAVIKFCF LLNIRFTKMW 60 QELSVKVVCY CGAFAWKNR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF032298 | 4e-39 | KF032298.1 Leavenworthia alabamica pop-variant Russellville self-incompatibility gene locus, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009108500.1 | 3e-28 | PREDICTED: myb-related protein 315-like | ||||
| Swissprot | Q9LDR8 | 1e-27 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | A0A397YHZ9 | 8e-27 | A0A397YHZ9_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4DWJ8 | 8e-27 | M4DWJ8_BRARP; Uncharacterized protein | ||||
| STRING | Bra020892.1-P | 1e-27 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22806 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21440.1 | 6e-30 | MYB-like 102 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




