PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC18210_p1
Organism
Raphanus raphanistrum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 83aa    MW: 9692.89 Da    PI: 10.2799
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC18210_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-192168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l++ ++ +G g+W++ +r+ g+ Rt+k+c++rw++yl
      RrC18210_p1 21 RGPWTAEEDFKLANHIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
                     89*********************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9371672IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-221678IPR009057Homeodomain-like
SuperFamilySSF466893.8E-191678IPR009057Homeodomain-like
SMARTSM007175.9E-142070IPR001005SANT/Myb domain
PfamPF002491.0E-162168IPR001005SANT/Myb domain
CDDcd001673.11E-112368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MDEKGRSFKN NNMEDEMDLK RGPWTAEEDF KLANHIATHG EGRWNSLSRC AGLQRTGKSC  60
RLRWLNYLRP DVRRGNITLK NNS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382871e-110KF738287.1 Brassica napus MYB transcription factor 108-2 (MYB108-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018490800.12e-52PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-48MY108_ARATH; Transcription factor MYB108
TrEMBLA0A1J3GEQ03e-50A0A1J3GEQ0_NOCCA; Uncharacterized protein (Fragment)
TrEMBLA0A3P5ZN605e-48A0A3P5ZN60_BRACM; Uncharacterized protein
TrEMBLM4CAH35e-48M4CAH3_BRARP; Uncharacterized protein
STRINGBra001202.1-P8e-49(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.16e-51myb domain protein 108
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cheng HQ, et al.
    The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection.
    J. Exp. Bot., 2016. 67(6): p. 1935-50
    [PMID:26873979]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  4. Chou ML, et al.
    The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana.
    Int J Mol Sci, 2018.
    [PMID:29937503]