![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC18389_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 44aa MW: 5245.91 Da PI: 4.9692 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 38.5 | 2.7e-12 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g WT+eEde+l+ +++++G+ +W++I+++
RrC18389_p1 14 KGEWTAEEDEKLIAYINEHGMCDWRSIPKR 43
799************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.459 | 9 | 44 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.93E-9 | 10 | 43 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 7.9E-12 | 12 | 43 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.9E-10 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.13E-6 | 16 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 44 aa Download sequence Send to blast |
MGRKTWFDDD GMKKGEWTAE EDEKLIAYIN EHGMCDWRSI PKRA |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF974753 | 5e-34 | KF974753.1 Brassica napus MYB transcription factor 47 (MYB47.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018449168.1 | 5e-25 | PREDICTED: transcription factor MYB80-like isoform X1 | ||||
| Refseq | XP_018449169.1 | 5e-25 | PREDICTED: transcription factor MYB80-like isoform X2 | ||||
| Refseq | XP_018450642.1 | 5e-25 | PREDICTED: transcription factor MYB80-like isoform X1 | ||||
| Refseq | XP_018450643.1 | 5e-25 | PREDICTED: transcription factor MYB80-like isoform X2 | ||||
| TrEMBL | A0A397YE84 | 4e-22 | A0A397YE84_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6F6A3 | 2e-22 | A0A3P6F6A3_BRAOL; Uncharacterized protein (Fragment) | ||||
| TrEMBL | M4DJ68 | 4e-22 | M4DJ68_BRARP; Uncharacterized protein | ||||
| STRING | Bra016546.1-P | 6e-23 | (Brassica rapa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18710.1 | 9e-24 | myb domain protein 47 | ||||




