![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC18799_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 61aa MW: 7107.84 Da PI: 6.2266 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.4 | 5.3e-11 | 31 | 60 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+WT+eEd+ll ++v+ G g+W+++a +
RrC18799_p1 31 KGPWTPEEDKLLTEYVASNGEGRWSSVATC 60
79*************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.47 | 26 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.08E-8 | 29 | 60 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 30 | 60 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.5E-9 | 31 | 59 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.44E-6 | 33 | 60 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MLDWKVDQVH QRNHDHEPYQ KPQQQLQGCR KGPWTPEEDK LLTEYVASNG EGRWSSVATC 60 A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013619948.1 | 4e-31 | PREDICTED: myb-related protein 340-like | ||||
| TrEMBL | A0A078HEB1 | 1e-31 | A0A078HEB1_BRANA; BnaC02g38100D protein | ||||
| TrEMBL | A0A0D3AWQ3 | 1e-31 | A0A0D3AWQ3_BRAOL; Uncharacterized protein | ||||
| STRING | Bo2g149430.1 | 2e-32 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM31175 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30210.1 | 2e-20 | myb domain protein 121 | ||||




