 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC19123_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 60aa MW: 6804.93 Da PI: 10.8193 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.9 | 4.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ienk+ rq+tfskRrng++KKA+ELSvLCda+va i+fs++gklye+ss
RrC19123_p1 9 KKIENKTSRQITFSKRRNGLFKKAHELSVLCDAQVAAIVFSQSGKLYEFSS 59
78***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.959 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 6.1E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.98E-36 | 3 | 60 | No hit | No description |
| SuperFamily | SSF55455 | 5.23E-30 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.8E-29 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MVRGKIEIKK IENKTSRQIT FSKRRNGLFK KAHELSVLCD AQVAAIVFSQ SGKLYEFSSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 2e-17 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 2e-17 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 2e-17 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 2e-17 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 2e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_B | 2e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_C | 2e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_D | 2e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC232439 | 5e-84 | AC232439.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003D07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018475523.1 | 3e-35 | PREDICTED: MADS-box protein AGL71-like isoform X1 | ||||
| Refseq | XP_018475524.1 | 3e-35 | PREDICTED: MADS-box protein AGL71-like isoform X2 | ||||
| Refseq | XP_018475525.1 | 3e-35 | PREDICTED: MADS-box protein AGL71-like isoform X3 | ||||
| Refseq | XP_022553174.1 | 8e-36 | serum response factor homolog B-like | ||||
| Swissprot | Q9LT93 | 2e-32 | AGL71_ARATH; MADS-box protein AGL71 | ||||
| TrEMBL | A0A078HLV8 | 5e-33 | A0A078HLV8_BRANA; BnaA03g12970D protein | ||||
| TrEMBL | A0A397ZUY7 | 6e-33 | A0A397ZUY7_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4EK37 | 6e-33 | M4EK37_BRARP; Uncharacterized protein | ||||
| STRING | Bra029154.1-P | 1e-33 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.2 | 4e-35 | AGAMOUS-like 71 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|