![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC19301_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 83aa MW: 9658.94 Da PI: 8.9563 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 110.1 | 1.1e-34 | 35 | 83 | 4 | 52 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52
+a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvG
RrC19301_p1 35 TAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVG 83
5678********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-20 | 34 | 83 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 26.599 | 37 | 83 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.1E-29 | 37 | 83 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 39 | 75 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MMLPYNAHNS YQPQFPSSEI EIPEKWKVPY GHDETAPPCP RCASSNTKFC YYNNYSLSQP 60 RYFCKGCRRY WTKGGSLRNI PVG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493472 | 3e-61 | AB493472.1 Arabidopsis thaliana At1g21340 gene for hypothetical protein, partial cds, clone: RAAt1g21340. | |||
| GenBank | AC015447 | 3e-61 | AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence. | |||
| GenBank | CP002684 | 3e-61 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | DQ446268 | 3e-61 | DQ446268.1 Arabidopsis thaliana clone pENTR221-At1g21340 Dof-type zinc finger domain-containing protein (At1g21340) mRNA, complete cds. | |||
| GenBank | DQ652847 | 3e-61 | DQ652847.1 Arabidopsis thaliana clone 0000013461_0000009694 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018469237.1 | 6e-58 | PREDICTED: dof zinc finger protein DOF1.2 | ||||
| Swissprot | P68349 | 5e-43 | DOF12_ARATH; Dof zinc finger protein DOF1.2 | ||||
| TrEMBL | A0A078IJR1 | 3e-54 | A0A078IJR1_BRANA; BnaA06g15080D protein | ||||
| TrEMBL | A0A3P5YF99 | 3e-54 | A0A3P5YF99_BRACM; Uncharacterized protein | ||||
| STRING | Bra017906.1-P | 6e-55 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6462 | 26 | 43 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G21340.1 | 2e-45 | Dof family protein | ||||




