![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC19533_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 167aa MW: 19540.2 Da PI: 9.9383 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 172.2 | 1.5e-53 | 16 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97
l pGfrFhPtdeelv++yLk+k+++++l++ e i+++diyk++PwdLp k++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+ ++
RrC19533_p1 16 LLPGFRFHPTDEELVSFYLKRKIQHNPLSI-ELIRQLDIYKYDPWDLP-KFATGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSeGN 111
579***************************.89***************.777899***************************************9566 PP
NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128
+ +glkk+Lvfykgra kg+ktdW+mhe+r+
RrC19533_p1 112 KCIGLKKSLVFYKGRAAKGVKTDWMMHEFRM 142
67***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.32E-56 | 12 | 145 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 52.995 | 16 | 167 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.1E-26 | 18 | 142 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MGERNNDGDQ KMEEVLLPGF RFHPTDEELV SFYLKRKIQH NPLSIELIRQ LDIYKYDPWD 60 LPKFATGEKE WYFYCPRDRK YRNSSRPNRV TGAGFWKATG TDRPIYSSEG NKCIGLKKSL 120 VFYKGRAAKG VKTDWMMHEF RMPSLSEPSP SSKRFFDSPV SPNVSSR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swm_B | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swm_C | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swm_D | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swp_A | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swp_B | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swp_C | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 3swp_D | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
| 4dul_A | 3e-51 | 1 | 153 | 4 | 153 | NAC domain-containing protein 19 |
| 4dul_B | 3e-51 | 1 | 153 | 4 | 153 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189385 | 1e-163 | AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018450269.1 | 1e-120 | PREDICTED: protein FEZ-like | ||||
| Swissprot | Q9ZVH0 | 1e-108 | FEZ_ARATH; Protein FEZ | ||||
| TrEMBL | A0A397YNI4 | 1e-117 | A0A397YNI4_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3N6R3Z2 | 1e-117 | A0A3N6R3Z2_BRACR; Uncharacterized protein | ||||
| STRING | Bra016294.1-P | 1e-118 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM306 | 28 | 200 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26870.1 | 1e-110 | NAC family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




