![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC1974_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 128aa MW: 15014.5 Da PI: 11.1124 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.7 | 2.4e-17 | 33 | 77 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg+++ eE+e +++++ +G++ W++Ia++++ gRt++++k++w+++
RrC1974_p1 33 RGKFSFEEEETIIQLHSIMGNK-WSAIAARLP-GRTDNEIKNYWNTH 77
89********************.*********.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-11 | 14 | 40 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.7E-23 | 14 | 86 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 4.17 | 14 | 27 | IPR017877 | Myb-like domain |
| PROSITE profile | PS51294 | 25.266 | 28 | 82 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.4E-16 | 32 | 80 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.2E-16 | 33 | 77 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.84E-12 | 35 | 78 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.4E-23 | 41 | 79 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MVTETGELFP RMLRCGKSCR LRWTNYLRPD IKRGKFSFEE EETIIQLHSI MGNKWSAIAA 60 RLPGRTDNEI KNYWNTHIRK RLLKLGIDPL TPRYSNSQRL CFQILNIATK TRTTPPHTTS 120 LTRLTKPK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 7e-21 | 14 | 82 | 40 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in salt stress response. {ECO:0000305|PubMed:26139822}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:26139822}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF386932 | 2e-85 | AF386932.1 Arabidopsis thaliana Unknown protein mRNA, complete cds. | |||
| GenBank | BT001182 | 2e-85 | BT001182.1 Arabidopsis thaliana Unknown protein (At4g05100) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006288136.1 | 7e-50 | transcription factor MYB74 | ||||
| Swissprot | Q9M0Y5 | 1e-50 | MYB74_ARATH; Transcription factor MYB74 | ||||
| TrEMBL | A0A1J3CVE1 | 2e-49 | A0A1J3CVE1_NOCCA; Transcription factor MYB39 (Fragment) | ||||
| TrEMBL | A0A287HT22 | 3e-49 | A0A287HT22_HORVV; Uncharacterized protein | ||||
| STRING | Cagra.1981s0006.1.p | 2e-49 | (Capsella grandiflora) | ||||
| STRING | XP_006288136.1 | 3e-49 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G05100.1 | 1e-52 | myb domain protein 74 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




