PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC20008_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 154aa MW: 18330.9 Da PI: 9.1768

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC20008_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.2	7.8e-18	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv + + +G g W+t +++ g++R++k+c++rw +yl RrC20008_p1 15 KGAWTPEEDQKLVSYLNNHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.058	10	66	IPR017930	Myb domain
SMART	SM00717	3.0E-12	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	5.9E-16	15	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.51E-21	16	90	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.1E-23	16	69	IPR009057	Homeodomain-like
CDD	cd00167	4.15E-8	17	62	No hit	No description
SMART	SM00717	0.11	67	111	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	7.483	67	113	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.1E-13	70	114	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 154 aa Download sequence Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLVSYL NNHGEGGWRT LPEKAGLKRC GKSCRLRWAN 60 YLRPDIKRGE FTEDEECSII SLHALHGNKF MGCYSSTDNE IKNYWNTHIK KRLIKKGVDP 120 VRKENQSECS LGDYRKWWPT HYYYYCYYYY KCHR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-19	13	113	5	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor positively regulating indolic glucosinolate biosynthetic pathway genes. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by touch or wounding. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23115560}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117331	1e-110	AK117331.1 Arabidopsis thaliana At1g18570 mRNA for unknown protein, complete cds, clone: RAFL16-90-B03.
GenBank	AY519555	1e-110	AY519555.1 Arabidopsis thaliana MYB transcription factor (At1g18570) mRNA, complete cds.
GenBank	BT006244	1e-110	BT006244.1 Arabidopsis thaliana At1g18570 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018480558.1	1e-77	PREDICTED: transcription factor MYB51
Swissprot	O49782	2e-74	MYB51_ARATH; Transcription factor MYB51
TrEMBL	A0A078G172	1e-74	A0A078G172_BRANA; BnaC05g14250D protein
STRING	Bo5g025570.1	3e-75	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18570.1	3e-76	myb domain protein 51

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Peskan-Berghöfer T, et al. Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Xu J, et al. Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. Plant Cell, 2016. 28(5): p. 1144-62 [PMID:27081184] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907]