![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC20249_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 66aa MW: 7458.81 Da PI: 9.8586 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 46.7 | 7e-15 | 6 | 62 | 18 | 74 |
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtl 74
++++P arikki++adedv +i+ +Pvl+sk+ elf+ +l r++ + e +t+
RrC20249_p1 6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTV 62
5789******************************************99999888886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.5E-24 | 3 | 64 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.38E-15 | 4 | 64 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.3E-18 | 8 | 66 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKSLE LFLQDLCDRT YEITLERGAK 60 TVSSLH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_A | 2e-21 | 2 | 66 | 5 | 69 | Transcription Regulator NC2 alpha chain |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353067 | 1e-75 | AK353067.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-D23. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006471321.1 | 1e-39 | dr1-associated corepressor-like isoform X3 | ||||
| Refseq | XP_015383655.1 | 1e-39 | dr1-associated corepressor-like isoform X3 | ||||
| Refseq | XP_024952618.1 | 8e-40 | dr1-associated corepressor-like isoform X9 | ||||
| Swissprot | Q14919 | 2e-19 | NC2A_HUMAN; Dr1-associated corepressor | ||||
| TrEMBL | A0A078EI38 | 4e-38 | A0A078EI38_BRANA; Transcription factor subunit NF-YC11B | ||||
| TrEMBL | A0A078IKW1 | 4e-38 | A0A078IKW1_BRANA; BnaA01g30580D protein | ||||
| TrEMBL | A0A0B2PUJ1 | 2e-38 | A0A0B2PUJ1_GLYSO; Dr1-associated corepressor | ||||
| TrEMBL | A0A0D3BAY0 | 4e-38 | A0A0D3BAY0_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P5ZCG8 | 4e-38 | A0A3P5ZCG8_BRACM; Uncharacterized protein | ||||
| STRING | AT3G12480.1 | 7e-39 | (Arabidopsis thaliana) | ||||
| STRING | Bo3g064920.1 | 6e-39 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3506 | 24 | 58 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12480.1 | 7e-43 | nuclear factor Y, subunit C11 | ||||




