![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC20253_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | BBR-BPC | ||||||||
| Protein Properties | Length: 55aa MW: 6293.24 Da PI: 11.5383 | ||||||||
| Description | BBR-BPC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GAGA_bind | 107.5 | 3.7e-33 | 1 | 55 | 247 | 301 |
GAGA_bind 247 stkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
++++r++Ri+grKmS+++f++lL++La+eG+dls pvDLkd+WA+HGtn+++ i+
RrC20253_p1 1 MPNKRHSRIGGRKMSGNVFSRLLSRLAGEGHDLSSPVDLKDYWARHGTNRYIIIK 55
79**************************************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF06217 | 1.1E-30 | 1 | 55 | IPR010409 | GAGA-binding transcriptional activator |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 55 aa Download sequence Send to blast |
MPNKRHSRIG GRKMSGNVFS RLLSRLAGEG HDLSSPVDLK DYWARHGTNR YIIIK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189521 | 2e-58 | AC189521.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB091M07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013598019.1 | 7e-33 | PREDICTED: protein BASIC PENTACYSTEINE5-like isoform X1 | ||||
| Refseq | XP_013706798.1 | 7e-33 | protein BASIC PENTACYSTEINE5 isoform X1 | ||||
| Swissprot | F4JUI3 | 6e-30 | BPC5_ARATH; Protein BASIC PENTACYSTEINE5 | ||||
| TrEMBL | A0A078GAI9 | 2e-31 | A0A078GAI9_BRANA; BnaA06g37280D protein | ||||
| TrEMBL | A0A0D3DIF6 | 2e-31 | A0A0D3DIF6_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A397Z737 | 2e-31 | A0A397Z737_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6F1T2 | 2e-31 | A0A3P6F1T2_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g119540.1 | 4e-32 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM30335 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38910.1 | 1e-32 | basic pentacysteine 5 | ||||




