![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC22257_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 86aa MW: 9165.91 Da PI: 9.4253 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 67.4 | 3.3e-21 | 32 | 80 | 1 | 49 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
+CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll+ +
RrC22257_p1 32 PCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHRVFGASNIIKLLQVA 80
7********************************************9865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 16.322 | 31 | 86 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 2.3E-20 | 32 | 79 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MLDMESKGDA SAAIIYASPA SSPPPPRVVL SPCAACKILR RRCGEKCVLA PYFPPTEPAK 60 FSIAHRVFGA SNIIKLLQVA NSLLLV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-17 | 31 | 78 | 10 | 57 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-17 | 31 | 78 | 10 | 57 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013603026.1 | 3e-50 | PREDICTED: LOB domain-containing protein 1-like | ||||
| Swissprot | Q9LQR0 | 9e-32 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
| TrEMBL | A0A078GDJ4 | 5e-49 | A0A078GDJ4_BRANA; BnaC08g43470D protein | ||||
| TrEMBL | A0A0D3DYI0 | 8e-49 | A0A0D3DYI0_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6FMJ1 | 8e-49 | A0A3P6FMJ1_BRAOL; Uncharacterized protein | ||||
| STRING | Bo8g112780.1 | 1e-49 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM20654 | 4 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07900.1 | 4e-32 | LOB domain-containing protein 1 | ||||




