![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC22570_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 101aa MW: 11864.6 Da PI: 10.6164 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54 | 3.9e-17 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd++l +++ +G g W+++a+ g++Rt+k+c++rw++yl
RrC22570_p1 25 KGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 72
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.123 | 20 | 76 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-22 | 20 | 75 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.2E-12 | 24 | 74 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 9.39E-22 | 26 | 101 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.51E-8 | 27 | 72 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.4E-9 | 76 | 101 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.552 | 77 | 101 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MKKTRRGKER ITSTKEEEEE GRVRKGPWTM EEDLILFNYI LNHGEGLWNS VAKASGLKRT 60 GKSCRLRWLN YLRPDVRRGN ITAEEQHLII QLHAKLGNRY S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 6e-16 | 25 | 101 | 27 | 102 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK118091 | 1e-103 | AK118091.1 Arabidopsis thaliana At3g01530 mRNA for putative transcription factor, complete cds, clone: RAFL19-34-G03. | |||
| GenBank | BT005574 | 1e-103 | BT005574.1 Arabidopsis thaliana clone U50886 putative myb family transcription factor (At3g01530) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018489878.1 | 3e-65 | PREDICTED: transcription factor MYB57-like | ||||
| Swissprot | Q9SSA1 | 8e-56 | MYB57_ARATH; Transcription factor MYB57 | ||||
| TrEMBL | A0A0D3B995 | 4e-57 | A0A0D3B995_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g055110.1 | 6e-58 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01530.1 | 1e-55 | myb domain protein 57 | ||||




