PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC24434_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

G2-like

Protein Properties

Length: 101aa MW: 11030 Da PI: 11.3227

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC24434_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	103.7	1.1e-32	32	85	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 prlrWtpeLH++F++av LGG+++AtPk il++m+vkgLt++hvkSHLQ+YR RrC24434_p1 32 PRLRWTPELHRCFLNAVYVLGGHHRATPKLILKMMDVKGLTISHVKSHLQMYRG 85 8****************************************************5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.738	28	88	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.1E-30	28	85	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.61E-16	32	84	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.5E-24	32	85	IPR006447	Myb domain, plants
Pfam	PF00249	2.0E-9	33	84	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MGTCGGRNGN DVGFNSQGGG GRVRPYVRSP VPRLRWTPEL HRCFLNAVYV LGGHHRATPK 60 LILKMMDVKG LTISHVKSHL QMYRGSKLTL GKSVCTIGIV S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	4e-20	33	87	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009101280.1	2e-55	PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
Refseq	XP_013664978.1	1e-55	putative Myb family transcription factor At1g14600 isoform X1
Refseq	XP_013727789.1	1e-55	putative Myb family transcription factor At1g14600 isoform X1
Refseq	XP_013727790.1	1e-55	putative Myb family transcription factor At1g14600 isoform X2
Refseq	XP_022543684.1	2e-55	putative Myb family transcription factor At1g14600 isoform X2
Refseq	XP_022543693.1	2e-55	putative Myb family transcription factor At1g14600 isoform X3
Swissprot	Q700D9	9e-37	MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBL	A0A078FXY6	3e-54	A0A078FXY6_BRANA; BnaA06g34360D protein
TrEMBL	A0A397ZDB8	4e-54	A0A397ZDB8_BRACM; Uncharacterized protein
TrEMBL	A0A3P5YM07	4e-54	A0A3P5YM07_BRACM; Uncharacterized protein
TrEMBL	M4E7T0	4e-54	M4E7T0_BRARP; Uncharacterized protein
STRING	Bra024836.1-P	6e-55	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM363	28	184

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02060.1	6e-32	G2-like family protein