PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC24994_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

Dof

Protein Properties

Length: 130aa MW: 14434.5 Da PI: 10.0621

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC24994_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124.4	3.7e-39	52	110	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k RrC24994_p1 52 PDKIIACPRCKSMETKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKSKP 110 68999***************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	1.0E-29	51	109	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.2E-32	54	109	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.043	56	110	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	58	94	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MATQNSQGIK LFGKTIAFNV NITQTIKSEE DKPPSDPVAR SSSSDPTVEK RPDKIIACPR 60 CKSMETKFCY FNNYNANQPR HFCKSCHRYW TAGGALRNVP VGAGRRKSKP LGRVVIGMLG 120 DGNEVHHVEL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC002341	3e-78	AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence.
GenBank	AK221308	3e-78	AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19.
GenBank	BT010496	3e-78	BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds.
GenBank	CP002685	3e-78	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018465685.1	6e-93	PREDICTED: cyclic dof factor 4-like
Swissprot	O22967	2e-71	CDF4_ARATH; Cyclic dof factor 4
TrEMBL	A0A078HH54	2e-80	A0A078HH54_BRANA; BnaA04g19980D protein
TrEMBL	A0A0D3C423	2e-80	A0A0D3C423_BRAOL; Uncharacterized protein
TrEMBL	A0A397ZMS7	2e-80	A0A397ZMS7_BRACM; Uncharacterized protein
TrEMBL	A0A3P6CM65	2e-80	A0A3P6CM65_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6D5W7	2e-80	A0A3P6D5W7_BRACM; Uncharacterized protein
STRING	Bo4g182410.1	4e-81	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2809	26	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34140.1	8e-74	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]