PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2575_p4
Organism
Raphanus raphanistrum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 129aa    MW: 14732.8 Da    PI: 11.4535
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2575_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31e-321874158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  RrC2575_p4 18 NEPMFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 74
                59****************************.**************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-361677IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.1551777IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.7E-271974IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-232042IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602242IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-235174IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MMGLVTSRVP LPHNYQENEP MFVNAKQYHA ILRRRKHRAK LEAQNKLIKS RKPYLHESRH  60
LHALKRARGS GGRFLNTKKK LQESSNSLCS SSITPSSSSD RDNMFQNPPF RFSGYPSTTH  120
HVSALMSGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-221895277NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876841e-71KC787684.1 Brassica napus transcription factor subunit NF-YA5B (NF-YA5B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018489439.14e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_018489440.14e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_018489441.14e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_018489443.14e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_018489444.14e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_018489445.15e-80PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X2
SwissprotQ9SYH46e-66NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078JTP53e-74A0A078JTP5_BRANA; BnaAnng31560D protein
TrEMBLA0A3P5ZDJ83e-74A0A3P5ZDJ8_BRACM; Uncharacterized protein
STRINGBra014368.1-P7e-75(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-61nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gao W,Liu W,Zhao M,Li WX
    NERF encodes a RING E3 ligase important for drought resistance and enhances the expression of its antisense gene NFYA5 in Arabidopsis.
    Nucleic Acids Res., 2015. 43(1): p. 607-17
    [PMID:25514924]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  4. Nasim Z,Fahim M,Ahn JH
    Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay.
    Front Plant Sci, 2017. 8: p. 191
    [PMID:28261246]
  5. Du Q,Zhao M,Gao W,Sun S,Li WX
    microRNA/microRNA* complementarity is important for the regulation pattern of NFYA5 by miR169 under dehydration shock in Arabidopsis.
    Plant J., 2017. 91(1): p. 22-33
    [PMID:28332758]
  6. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]