![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC27316_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 131aa MW: 15011.2 Da PI: 10.3707 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.1 | 1.2e-18 | 33 | 67 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C t Tp+WR gp g+ktLCnaCG++y++ +l
RrC27316_p1 33 CVHCATDRTPQWRTGPMGPKTLCNACGVRYKSGRL 67
*******************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.1E-17 | 27 | 77 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 5.23E-16 | 28 | 91 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 3.6E-15 | 31 | 65 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 11.53 | 31 | 63 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 1.53E-13 | 32 | 79 | No hit | No description |
| Pfam | PF00320 | 1.7E-16 | 33 | 67 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 33 | 58 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
PTPTAQLWKK LAVDAYRQKK DSSPESGGVE RRCVHCATDR TPQWRTGPMG PKTLCNACGV 60 RYKSGRLVPE YRPVASPTFV LTKHSNSHRR VMELRRQKMT KSRHEFIHHR YGKDTAMILD 120 VSSDGDDYLI Q |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC172883 | 1e-116 | AC172883.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH125N23, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018456159.1 | 6e-88 | PREDICTED: GATA transcription factor 12-like | ||||
| Swissprot | P69781 | 5e-62 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A397XR53 | 3e-73 | A0A397XR53_BRACM; GATA transcription factor | ||||
| STRING | Bra036555.1-P | 2e-72 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM12987 | 24 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G25830.1 | 2e-64 | GATA transcription factor 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




