![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC27413_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 56aa MW: 6609.62 Da PI: 8.0394 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 27.2 | 6.5e-09 | 17 | 51 | 3 | 37 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkkl 37
k ++t+eq+e+Le+l++ +++ps +r++L +++
RrC27413_p1 17 KYVRYTPEQVEALERLYHDCPKPSSIRRQQLIREC 51
5679**************************98776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-8 | 13 | 51 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 9.84E-8 | 16 | 52 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.20E-6 | 17 | 51 | No hit | No description |
| Pfam | PF00046 | 1.6E-6 | 17 | 51 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MEMSYKDGKM GCMDNGKYVR YTPEQVEALE RLYHDCPKPS SIRRQQLIRE CPILSN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation. May regulates procambial and vascular tissue formation or maintenance, and vascular development in inflorescence stems. {ECO:0000269|PubMed:15598805, ECO:0000269|PubMed:15705957, ECO:0000269|PubMed:16617092}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin. Repressed by miR165 and miR166. {ECO:0000269|PubMed:15773855, ECO:0000269|PubMed:16033795, ECO:0000269|PubMed:16617092, ECO:0000269|PubMed:17237362}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JN975042 | 9e-64 | JN975042.1 Brassica napus corona (CNA.2) gene, partial sequence. | |||
| GenBank | JN975043 | 9e-64 | JN975043.1 Brassica napus corona (CNA.1) gene, partial sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018451524.1 | 9e-34 | PREDICTED: homeobox-leucine zipper protein ATHB-15-like | ||||
| Swissprot | Q9ZU11 | 6e-32 | ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15 | ||||
| TrEMBL | M4DCU8 | 1e-31 | M4DCU8_BRARP; Uncharacterized protein | ||||
| STRING | Bra014315.1-P | 2e-32 | (Brassica rapa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G52150.1 | 2e-34 | HD-ZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




