PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC2769_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

NAC

Protein Properties

Length: 151aa MW: 17853.3 Da PI: 9.7383

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC2769_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	168.6	2.1e-52	16	144	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++ ++ + +++wyfFs++dkky+tg+r+nrat sg+Wkatg+dk ++s RrC2769_p1 16 VPPGFRFHPTEEELLHYYLRKKVHSQKIDL-DVIREVDLNKLEPWDIQEecRIGStPQNDWYFFSHKDKKYPTGTRTNRATVSGFWKATGRDKIIYS-C 112 69**************************.9***********963433332456*********************************9.9 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 + +gl+ktLvfy+grap+g+k+dW+mheyrl RrC2769_p1 113 VRRIGLRKTLVFYQGRAPHGQKSDWIMHEYRL 144 999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.29E-54	12	149	IPR003441	NAC domain
PROSITE profile	PS51005	51.519	16	151	IPR003441	NAC domain
Pfam	PF02365	4.2E-28	17	144	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 151 aa Download sequence Send to blast
MAENKVNLSI NGQSKVPPGF RFHPTEEELL HYYLRKKVHS QKIDLDVIRE VDLNKLEPWD 60 IQEECRIGST PQNDWYFFSH KDKKYPTGTR TNRATVSGFW KATGRDKIIY SCVRRIGLRK 120 TLVFYQGRAP HGQKSDWIMH EYRLDETPTI N

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-47	12	144	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269\|PubMed:17114348, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250, ECO:0000269\|PubMed:17565617, ECO:0000269\|PubMed:17890373}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF974755	0.0	KF974755.1 Brassica napus NAC transcription factor 12-1 (NAC12-1.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018483348.1	1e-109	PREDICTED: NAC domain-containing protein 12-like
Swissprot	Q9LPI7	1e-104	NAC12_ARATH; NAC domain-containing protein 12
TrEMBL	A0A0D3CDT9	1e-107	A0A0D3CDT9_BRAOL; Uncharacterized protein
STRING	Bo5g049360.1	1e-108	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM778	28	124

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G32770.1	1e-106	NAC domain containing protein 12

Publications ? help Back to Top
Zhao Q, et al. Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis. Phytochemistry, 2015. 112: p. 170-8 [PMID:25107662] Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana. J. Plant Physiol., 2015. 175: p. 86-94 [PMID:25506770] Sakamoto S,Mitsuda N Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant. Plant Cell Physiol., 2015. 56(2): p. 299-310 [PMID:25535195] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Huang J,Chen F,Wu S,Li J,Xu W Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis. Sci China Life Sci, 2016. 59(2): p. 194-205 [PMID:26803299] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073]