![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC28592_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 70aa MW: 7773.53 Da PI: 11.1637 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 141.5 | 1.6e-44 | 2 | 70 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+++k+e+kGlnPGlivllv+gglll flvgn+ily+yaqknlPPrkkkPvskkk+k+e+lkqGv vPGe
RrC28592_p1 2 KQGKIESKGLNPGLIVLLVIGGLLLAFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEQLKQGVRVPGE 70
5789****************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.2E-39 | 6 | 70 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MKQGKIESKG LNPGLIVLLV IGGLLLAFLV GNFILYTYAQ KNLPPRKKKP VSKKKMKKEQ 60 LKQGVRVPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 6e-24 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 6e-24 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 8e-17 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | W9SCA3 | 1e-22 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 2e-23 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09735.1 | 4e-06 | S1FA-like DNA-binding protein | ||||




