PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3475_p4
Organism
Raphanus raphanistrum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YB
Protein Properties Length: 75aa    MW: 8595.99 Da    PI: 7.1802
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3475_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB81.11.5e-256534592
       NF-YB 45 fvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                 +ts asdkcqrekrktingddllwa++tlGfe+yveplk yl++yre
  RrC3475_p4  6 ILTSRASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKFYLTRYRE 53
                689********************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.36E-17454IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.0E-22554IPR009072Histone-fold
PfamPF008082.0E-6732IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.9E-111533No hitNo description
PRINTSPR006155.9E-113452No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MGVVYILTSR ASDKCQREKR KTINGDDLLW AMTTLGFEEY VEPLKFYLTR YRESPVISVA  60
SLSEAGVCCM NLLFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-194534392Transcription factor HapC (Eurofung)
4g92_B2e-194534392Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892695e-54AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018493235.15e-27PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotO233101e-24NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
SwissprotP252092e-24NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLA0A397Y0302e-25A0A397Y030_BRACM; Uncharacterized protein
TrEMBLA0A3P5Y5373e-25A0A3P5Y537_BRACM; Uncharacterized protein (Fragment)
TrEMBLM4CRZ92e-25M4CRZ9_BRARP; Uncharacterized protein
STRINGBra006991.1-P4e-26(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-27nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Li XY, et al.
    Evolutionary variation of the CCAAT-binding transcription factor NF-Y.
    Nucleic Acids Res., 1992. 20(5): p. 1087-91
    [PMID:1549471]
  2. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  3. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  4. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]