PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC3639_p4

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

NAC

Protein Properties

Length: 72aa MW: 8148.32 Da PI: 4.7148

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC3639_p4	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	58.6	2.2e-18	17	64	1	49
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 +ppGfrFhPt+eel+++yLkkkv+ ++++l +vi+evd++k+ePw+L++ RrC3639_p4 17 VPPGFRFHPTEEELLHYYLKKKVSYEPIDL-DVIREVDLNKLEPWELKA 64 69**************************.9*************73 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-18	9	64	IPR003441	NAC domain
PROSITE profile	PS51005	20.011	17	72	IPR003441	NAC domain
Pfam	PF02365	3.6E-8	18	60	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 72 aa Download sequence Send to blast
MEIGTSSTVA GGGQLSVPPG FRFHPTEEEL LHYYLKKKVS YEPIDLDVIR EVDLNKLEPW 60 ELKASQSLSL LF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189312	3e-73	AC189312.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034L08, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018459716.1	6e-39	PREDICTED: protein SOMBRERO-like
Swissprot	Q9MA17	8e-37	SMB_ARATH; Protein SOMBRERO
TrEMBL	A0A078JT11	4e-36	A0A078JT11_BRANA; BnaCnng69540D protein (Fragment)
TrEMBL	A0A1J3DYK9	8e-37	A0A1J3DYK9_NOCCA; Protein SOMBRERO (Fragment)
STRING	scaffold_202942.1	1e-36	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79580.3	3e-39	NAC family protein

Publications ? help Back to Top
Fendrych M, et al. Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis. Curr. Biol., 2014. 24(9): p. 931-40 [PMID:24726156] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Karve R,Suárez-Román F,Iyer-Pascuzzi AS The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release. Plant Physiol., 2016. 171(3): p. 2101-11 [PMID:27221617] Kamiya M, et al. Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis. Development, 2016. 143(21): p. 4063-4072 [PMID:27803060]