PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC3851_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

M-type_MADS

Protein Properties

Length: 65aa MW: 7278.49 Da PI: 11.3844

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC3851_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.9	4.1e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+n++nrqvtfskRrng++KKA+EL +LCdaev +iifsstg+lye+ss RrC3851_p1 9 KRIDNSTNRQVTFSKRRNGLMKKAKELAILCDAEVGLIIFSSTGRLYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.632	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.4E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.28E-37	2	62	No hit	No description
SuperFamily	SSF55455	3.14E-30	2	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MGRGKIAIKR IDNSTNRQVT FSKRRNGLMK KAKELAILCD AEVGLIIFSS TGRLYEFSSS 60 RTGQK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	5e-21	1	60	1	60	MEF2C
5f28_B	5e-21	1	60	1	60	MEF2C
5f28_C	5e-21	1	60	1	60	MEF2C
5f28_D	5e-21	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018468382.1	4e-36	PREDICTED: agamous-like MADS-box protein AGL16 isoform X1
Refseq	XP_018468383.1	3e-36	PREDICTED: agamous-like MADS-box protein AGL16 isoform X2
Swissprot	A2RVQ5	2e-33	AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBL	A0A068F605	2e-32	A0A068F605_BRANA; Agamous-like protein 16
TrEMBL	A0A398APE6	2e-32	A0A398APE6_BRACM; Uncharacterized protein
STRING	Bra011509.1-P	1e-32	(Brassica rapa)
STRING	Bo1g007520.1	1e-32	(Brassica oleracea)
STRING	Lus10028214	9e-33	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.2	6e-36	AGAMOUS-like 16

Publications ? help Back to Top
Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951]