![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC39330_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 60aa MW: 6721.86 Da PI: 10.7083 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.8 | 3.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien rqvtfskRrng++KKA+ELS+LCdaeva+iifsstgk+y++ss
RrC39330_p1 9 KKIENVNSRQVTFSKRRNGLMKKAKELSILCDAEVALIIFSSTGKVYDFSS 59
78***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.282 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-29 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.88E-36 | 2 | 59 | No hit | No description |
| PRINTS | PR00404 | 2.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.4E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRGRIEIKK IENVNSRQVT FSKRRNGLMK KAKELSILCD AEVALIIFSS TGKVYDFSSG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_B | 1e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_C | 1e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_D | 1e-19 | 1 | 59 | 1 | 59 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189231 | 7e-77 | AC189231.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB013M01, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018486852.1 | 5e-35 | PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 | ||||
| Swissprot | Q9M2K8 | 8e-34 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
| TrEMBL | A0A1J3D0Q2 | 3e-34 | A0A1J3D0Q2_NOCCA; Agamous-like MADS-box protein AGL18 (Fragment) | ||||
| TrEMBL | M4CGE5 | 7e-35 | M4CGE5_BRARP; Uncharacterized protein | ||||
| STRING | Bra003278.1-P | 1e-35 | (Brassica rapa) | ||||
| STRING | Bo6g072840.1 | 3e-34 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57390.1 | 3e-36 | AGAMOUS-like 18 | ||||




