![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC40065_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 110aa MW: 12723.3 Da PI: 4.9576 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 51.7 | 1.5e-16 | 2 | 45 | 44 | 87 |
-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
B3 44 rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
r+W+++++y+++s+++vlt+GW +Fvk++ L+e+D++vF+ ++
RrC40065_p1 2 RQWKFRYCYWRSSQSFVLTRGWIGFVKEKSLQEKDVIVFYTCKT 45
89**************************************5554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 11.406 | 1 | 63 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 3.53E-13 | 2 | 44 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene3D | G3DSA:2.40.330.10 | 6.4E-16 | 2 | 68 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 5.8E-14 | 2 | 47 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 4.54E-12 | 2 | 41 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MRQWKFRYCY WRSSQSFVLT RGWIGFVKEK SLQEKDVIVF YTCKTLEGGQ SKNFLMIDVH 60 CSSDDGSAVS DEEVNETVRN SSEEEVKTEG EETKSVENKG GFMLFGVRIQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC079828 | 6e-39 | AC079828.4 Arabidopsis thaliana chromosome 1 BAC F23H24 genomic sequence, complete sequence. | |||
| GenBank | AY560883 | 6e-39 | AY560883.1 Arabidopsis thaliana putative AP2/EREBP transcription factor (At1g51120) mRNA, complete cds. | |||
| GenBank | CP002684 | 6e-39 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018487669.1 | 3e-71 | PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g51120-like | ||||
| Refseq | XP_018487676.1 | 3e-71 | PREDICTED: AP2/ERF and B3 domain-containing transcription factor At1g51120-like | ||||
| Swissprot | Q9C6P5 | 7e-46 | RAVL2_ARATH; AP2/ERF and B3 domain-containing transcription factor At1g50680 | ||||
| TrEMBL | A0A078HID1 | 4e-54 | A0A078HID1_BRANA; BnaC06g03900D protein | ||||
| TrEMBL | A0A0D3CPU1 | 4e-54 | A0A0D3CPU1_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6GPU4 | 4e-54 | A0A3P6GPU4_BRAOL; Uncharacterized protein | ||||
| STRING | Bo6g022450.1 | 6e-55 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G50680.1 | 2e-41 | RAV family protein | ||||




