![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC4106_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 218aa MW: 24614.2 Da PI: 8.4595 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.6 | 1.2e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr gi+KKA ELS+LCda+va+iifs tgkl+e+ss
RrC4106_p1 9 KKIDNLTARQVTFSKRRRGIIKKAGELSILCDADVALIIFSATGKLFEFSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 62.3 | 1.8e-21 | 93 | 173 | 18 | 98 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
+ +l +L ke+e +++R+l G+dLe L+l+eLq+Le+ Le++l+++ +kK e +++qi+ l k+ el +en++Lr++l
RrC4106_p1 93 NCNLPRLSKEVEDKTKQLRQLRGDDLEGLNLEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL 173
55678999**********************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.114 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.6E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.75E-34 | 2 | 71 | No hit | No description |
| PRINTS | PR00404 | 6.1E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.96E-28 | 3 | 73 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.5E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 13.582 | 89 | 179 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.7E-18 | 93 | 173 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0010220 | Biological Process | positive regulation of vernalization response | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0048438 | Biological Process | floral whorl development | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 218 aa Download sequence Send to blast |
MAREKIRIKK IDNLTARQVT FSKRRRGIIK KAGELSILCD ADVALIIFSA TGKLFEFSSS 60 RYVMRDILGR YNLHASNINK MMGPPSPYHQ LENCNLPRLS KEVEDKTKQL RQLRGDDLEG 120 LNLEELQRLE KSLESGLSRV SEKKGECVMS QISSLEKRGS ELVDENRRLR EQLVTLEMAK 180 TMALKEAVET ESATTNVSSY DSGAPLEDDF SDTSLKLG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-16 | 1 | 71 | 1 | 69 | MEF2C |
| 5f28_B | 1e-16 | 1 | 71 | 1 | 69 | MEF2C |
| 5f28_C | 1e-16 | 1 | 71 | 1 | 69 | MEF2C |
| 5f28_D | 1e-16 | 1 | 71 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ906709 | 0.0 | JQ906709.1 Brassica napus clone AGL24-3 MADS-box protein AGL24 (AGL24) mRNA, complete cds. | |||
| GenBank | JQ906710 | 0.0 | JQ906710.1 Brassica napus clone AGL24-4 MADS-box protein AGL24 (AGL24) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018452703.1 | 1e-152 | PREDICTED: MADS-box protein AGL24 isoform X2 | ||||
| Swissprot | O82794 | 1e-128 | AGL24_ARATH; MADS-box protein AGL24 | ||||
| TrEMBL | I6TS39 | 1e-148 | I6TS39_BRANA; MADS-box protein AGL24 | ||||
| STRING | Bo1g039080.1 | 1e-147 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM14511 | 15 | 21 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24540.1 | 1e-118 | AGAMOUS-like 24 | ||||




