![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC426_p8 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 159aa MW: 18820.6 Da PI: 10.1213 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 98.9 | 2.1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr+g+lKKA+E+SvLCdaev++i+fs++gkl+eyss
RrC426_p8 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVSLIVFSHKGKLFEYSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 91.3 | 1.7e-30 | 85 | 159 | 9 | 83 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83
+ +++ e+++Lk++ie L+r+qRh+lGedLes+s+keLq+LeqqL++slk+iRs+Kn+l++e++++lq+k
RrC426_p8 85 SPVNAKTNWSMEYSRLKAKIELLERNQRHYLGEDLESISIKELQNLEQQLDTSLKHIRSRKNQLMHESLNHLQRK 159
45566789*****************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.20E-41 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 1.06E-34 | 2 | 85 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.2E-26 | 87 | 159 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 14.572 | 90 | 159 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MGRGRVEMKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVSLIVFSH KGKLFEYSSE 60 SCMEKVLERY ERYSYAEKQL KAPDSPVNAK TNWSMEYSRL KAKIELLERN QRHYLGEDLE 120 SISIKELQNL EQQLDTSLKH IRSRKNQLMH ESLNHLQRK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. {ECO:0000269|PubMed:10765981}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY514045 | 0.0 | AY514045.1 Brassica rapa var. communis DNA binding protein (CAL) mRNA, complete cds. | |||
| GenBank | AY514048 | 0.0 | AY514048.1 Brassica rapa subsp. rapa DNA binding protein (CAL) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018449538.1 | 1e-111 | PREDICTED: transcription factor CAULIFLOWER isoform X2 | ||||
| Refseq | XP_018451393.1 | 1e-111 | PREDICTED: transcription factor CAULIFLOWER isoform X2 | ||||
| Swissprot | Q9SBK9 | 1e-110 | CAL_BRARP; Transcription factor CAULIFLOWER | ||||
| TrEMBL | A0A078HE54 | 1e-109 | A0A078HE54_BRANA; BnaA08g19710D protein | ||||
| TrEMBL | A0A397YDR7 | 1e-109 | A0A397YDR7_BRACM; Uncharacterized protein | ||||
| STRING | Bra011021.1-P | 1e-109 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM792 | 25 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26310.1 | 1e-104 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




