PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC44391_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

G2-like

Protein Properties

Length: 171aa MW: 19269.6 Da PI: 9.5819

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC44391_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	84.2	1.3e-26	52	105	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kpr+ Wt eLH++F+ av++L G ekA Pk+ilelm+v+ Lt+e+v+SHLQk+R+ RrC44391_p1 52 KPRVLWTRELHNKFLAAVDHL-GVEKAQPKKILELMNVDKLTRENVASHLQKFRS 105 79*****************.******************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-28	49	110	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.564	49	108	IPR017930	Myb domain
SuperFamily	SSF46689	3.49E-20	50	109	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.5E-25	52	105	IPR006447	Myb domain, plants
Pfam	PF00249	5.3E-7	56	103	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
MKSIVTNVES TDNSDQNGVK ANRKRKDQFE EVGEEEDEER GNENDDPTAQ KKPRVLWTRE 60 LHNKFLAAVD HLGVEKAQPK KILELMNVDK LTRENVASHL QKFRSALKKI TNEANQQANM 120 AAIDSHFMQM SSLKGLGGFH HQQRQIPLGS GQFHGGAAAT MRHYPLGRLN S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	3e-35	48	111	1	64	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269\|PubMed:11574878}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353533	1e-134	AK353533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-50-C17.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018485275.1	1e-108	PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR10-like
Swissprot	O49397	8e-73	ARR10_ARATH; Two-component response regulator ARR10
TrEMBL	A0A0D3DHA4	2e-95	A0A0D3DHA4_BRAOL; Two-component response regulator
STRING	Bo7g115520.1	3e-96	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM15903	7	12

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G31920.1	3e-68	response regulator 10

Publications ? help Back to Top
Hill K,Schaller GE Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity. Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709 [PMID:23887495] Ramireddy E,Chang L,Schmülling T Cytokinin as a mediator for regulating root system architecture in response to environmental cues. Plant Signal Behav, 2014. 9(1): p. e27771 [PMID:24509549] Choi SH, et al. Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis. Sci Rep, 2014. 4: p. 7197 [PMID:25425016] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Street IH, et al. Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root. Development, 2016. 143(21): p. 3982-3993 [PMID:27697901] Wang Y,Wu Y,Yu B,Yin Z,Xia Y EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes. Plant Physiol., 2017. 173(2): p. 1235-1246 [PMID:27986866] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zubo YO, et al. Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004 [PMID:28673986] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938]