PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC44_p13

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

SRS

Protein Properties

Length: 114aa MW: 13268.3 Da PI: 9.4044

Description

SRS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC44_p13	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF702	95	1.6e-29	6	69	5	69
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaae 69 + +C+dCGnqakk+C+++RCRtCCk+++f+C+th+kstWvpa++r+++q ++++ + ++++ ++ RrC44_p13 6 GRRCEDCGNQAKKECVYMRCRTCCKTKAFHCQTHIKSTWVPAYRRSQKQLLQTQT-QPQEERLST 69 569****************************************999986555444.444444444 PP
2	DUF702	44.9	4.1e-14	63	114	84	135
DUF702 84 salsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqta 135 + +++s + + +++t ++P e+ss a frcv+vss+ddg+e++aYqt+ RrC44_p13 63 QEERLSTISPKRVRIHTTTGHFPVELSSVADFRCVKVSSIDDGKEQYAYQTT 114 334445556666677888889*****************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05142	2.9E-37	6	114	IPR007818	Protein of unknown function DUF702
TIGRFAMs	TIGR01623	8.6E-28	9	50	IPR006510	Zinc finger, lateral root primordium type 1
TIGRFAMs	TIGR01624	1.2E-14	83	114	IPR006511	Lateral Root Primordium type 1, C-terminal

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
MMMIMGRRCE DCGNQAKKEC VYMRCRTCCK TKAFHCQTHI KSTWVPAYRR SQKQLLQTQT 60 QPQEERLSTI SPKRVRIHTT TGHFPVELSS VADFRCVKVS SIDDGKEQYA YQTT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269\|PubMed:16740146}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC006841	1e-61	AC006841.7 Arabidopsis thaliana chromosome 2 clone F3K23 map mi148, complete sequence.
GenBank	CP002685	1e-61	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018438354.1	5e-73	PREDICTED: protein SHI RELATED SEQUENCE 3
Swissprot	Q9SJT8	4e-62	SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBL	D7LBD1	5e-60	D7LBD1_ARALL; Uncharacterized protein
STRING	fgenesh1_pm.C_scaffold_4000048	8e-61	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9188	26	38

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G21400.1	1e-62	SHI-related sequence3