![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC5014_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 61aa MW: 7037.24 Da PI: 10.6223 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 103.5 | 7.5e-33 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fs++gklye++s
RrC5014_p1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.319 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.15E-38 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 9.81E-31 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.8E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVSLIVFSN RGKLYEFCST 60 S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-20 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 3e-20 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 3e-20 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 3e-20 | 1 | 61 | 1 | 61 | MEF2C |
| 6byy_A | 2e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_B | 2e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_C | 2e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_D | 2e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_A | 3e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 3e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 3e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 3e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC967959 | 8e-86 | KC967959.1 Brassica oleracea var. viridis SEP2.b (SEP2.b) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009622386.1 | 9e-37 | PREDICTED: MADS-box protein CMB1-like | ||||
| Refseq | XP_022850778.1 | 3e-36 | MADS-box protein EJ2-like | ||||
| Swissprot | Q39685 | 9e-37 | CMB1_DIACA; MADS-box protein CMB1 | ||||
| TrEMBL | A0A103XKV5 | 3e-35 | A0A103XKV5_CYNCS; Transcription factor, K-box | ||||
| TrEMBL | A0A2K3MX45 | 3e-35 | A0A2K3MX45_TRIPR; MADS-box transcription factor sepallata3 (Fragment) | ||||
| TrEMBL | A0A2N9HF95 | 2e-35 | A0A2N9HF95_FAGSY; Uncharacterized protein | ||||
| STRING | cassava4.1_033924m | 2e-36 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G24260.3 | 2e-38 | MIKC_MADS family protein | ||||




