![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC53544_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 88aa MW: 9419.99 Da PI: 9.8467 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 65.7 | 1.1e-20 | 43 | 88 | 1 | 46 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
+CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l
RrC53544_p1 43 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFL 88
7******************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 17.314 | 42 | 88 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.3E-19 | 43 | 88 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
TSVAISAVKE TTTPVNSPSP TYSPPSPPLS PQQPQQSPVV LSPCAACKIL RRRCAEKCVL 60 APYFPPTDPA KFTIAHRVFG ASNIIKFL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 1e-16 | 37 | 88 | 5 | 56 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 1e-16 | 37 | 88 | 5 | 56 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013726732.1 | 2e-42 | LOB domain-containing protein 11-like | ||||
| Swissprot | Q9SK08 | 2e-33 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
| TrEMBL | A0A078JDD1 | 4e-35 | A0A078JDD1_BRANA; BnaA04g28360D protein | ||||
| TrEMBL | A0A291LQZ0 | 7e-35 | A0A291LQZ0_BRARR; Transcription factor LBD11 | ||||
| TrEMBL | A0A397ZLR9 | 7e-35 | A0A397ZLR9_BRACM; Uncharacterized protein | ||||
| STRING | Bra035698.1-P | 1e-35 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM20654 | 4 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07900.1 | 4e-29 | LOB domain-containing protein 1 | ||||




