![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC5633_p4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 56aa MW: 6035.1 Da PI: 11.0254 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 36.9 | 4.6e-12 | 15 | 52 | 2 | 39 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
+ienk r +tf+k r g+ KA L+v da++a++
RrC5633_p4 15 KIENKASRATTFTKHRDGLYSKAAQLCVVSDAQIAILA 52
69*********************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 14.493 | 6 | 56 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.5E-4 | 6 | 54 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.14E-13 | 7 | 54 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 5.89E-14 | 7 | 56 | No hit | No description |
| PRINTS | PR00404 | 6.1E-9 | 8 | 28 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.7E-12 | 15 | 52 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-9 | 28 | 43 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.1E-9 | 43 | 56 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MVKKGGTKRK PVMTKIENKA SRATTFTKHR DGLYSKAAQL CVVSDAQIAI LATPSS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018477225.1 | 3e-29 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Refseq | XP_018477620.1 | 7e-29 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Refseq | XP_018477643.1 | 8e-29 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Refseq | XP_018490867.1 | 6e-29 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Swissprot | Q9C633 | 6e-16 | AGL97_ARATH; Agamous-like MADS-box protein AGL97 | ||||
| TrEMBL | A0A397YU64 | 9e-22 | A0A397YU64_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P5YBQ9 | 1e-21 | A0A3P5YBQ9_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4DQD4 | 9e-22 | M4DQD4_BRARP; Uncharacterized protein | ||||
| STRING | Bra018727.1-P | 2e-22 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM454 | 17 | 145 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49420.1 | 1e-19 | M-type_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




