![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC59579_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 107aa MW: 12156.3 Da PI: 5.3126 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 68.9 | 9.7e-22 | 62 | 107 | 2 | 47 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47
Cqve+C+ad+s+ak+yh+rhkvCe+h+kap+v + g qrfCqqCs
RrC59579_p1 62 CQVERCTADMSRAKQYHKRHKVCEFHAKAPAVRIFGGYQRFCQQCS 107
*********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 7.9E-21 | 55 | 107 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 18.7 | 59 | 107 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 7.06E-20 | 61 | 107 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.5E-16 | 62 | 107 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MSVRRSNADG KRSLREMSEE EEEDEDTFEE EDNGGEQEQE EALEKKQKGK AASSSTSSGV 60 SCQVERCTAD MSRAKQYHKR HKVCEFHAKA PAVRIFGGYQ RFCQQCS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-18 | 54 | 107 | 2 | 56 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape. {ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:16914499, ECO:0000269|PubMed:9301089}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018465582.1 | 6e-53 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
| Swissprot | P93015 | 1e-35 | SPL3_ARATH; Squamosa promoter-binding-like protein 3 | ||||
| TrEMBL | A0A0D3B4R8 | 2e-40 | A0A0D3B4R8_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6ATU2 | 2e-40 | A0A3P6ATU2_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g027460.1 | 3e-41 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 1e-23 | squamosa promoter binding protein-like 3 | ||||




