![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC59920_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 121aa MW: 12699.8 Da PI: 5.1573 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 122.6 | 1.6e-38 | 1 | 65 | 33 | 97 |
NF-YB 33 etvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
etvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfedyveplk+yl+kyre+ege+
RrC59920_p1 1 ETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQKYREVEGER 65
79*************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 1.2E-13 | 1 | 39 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-34 | 1 | 77 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.59E-26 | 2 | 70 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 3.0E-22 | 3 | 21 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 6 | 22 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.0E-22 | 22 | 40 | No hit | No description |
| PRINTS | PR00615 | 3.0E-22 | 41 | 59 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
ETVQECVSEF ISFVTGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKIYLQKYRE 60 VEGERTTTTT TGRQGDKEGG GGGNGSSSSG GGVGGGGGYS ATTGGGMYGG IVTMGHHHQG 120 H |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-31 | 1 | 60 | 34 | 93 | NF-YB |
| 4awl_B | 6e-31 | 1 | 60 | 35 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 6e-31 | 1 | 60 | 35 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189218 | 1e-109 | AC189218.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F13, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018432710.1 | 6e-81 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | O23310 | 9e-49 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A1J3G450 | 2e-56 | A0A1J3G450_NOCCA; Nuclear transcription factor Y subunit B-3 (Fragment) | ||||
| STRING | XP_006406899.1 | 3e-53 | (Eutrema salsugineum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 2e-43 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




