PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC6142_p3

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

G2-like

Protein Properties

Length: 161aa MW: 18071.2 Da PI: 7.9485

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC6142_p3	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	79.3	4.7e-25	111	160	1	51
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 k r++W+ eLH++Fv av++L G +kA+Pk+ile+m+v gLt+e+v+SHLQ RrC6142_p3 111 KRRVVWSVELHQQFVAAVNHL-GVDKAVPKKILEIMNVSGLTRENVASHLQ 160 689****************.*************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50110	13.983	1	43	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF52172	1.99E-8	2	53	IPR011006	CheY-like superfamily
Gene3D	G3DSA:3.40.50.2300	1.2E-11	3	78	No hit	No description
PROSITE profile	PS51294	13.656	108	161	IPR017930	Myb domain
SuperFamily	SSF46689	7.7E-16	109	160	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.1E-24	110	160	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	4.2E-23	111	161	IPR006447	Myb domain, plants
Pfam	PF00249	8.2E-7	113	160	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MFLVMSADES KSVVLKGVTH GAVDYLIKPV RMEALKNIWQ HVVRKKRNVS EHSGSVEETT 60 GGDRQQQQRD DDGDGENNSS SGNNEGRRKR KKEEEVEEQG GDREDSSSLK KRRVVWSVEL 120 HQQFVAAVNH LGVDKAVPKK ILEIMNVSGL TRENVASHLQ V

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	3e-20	110	160	4	54	ARR10-B
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	87	91	RKRKK
2	87	92	RKRKKE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018478856.1	8e-91	PREDICTED: two-component response regulator ARR2-like isoform X2
Swissprot	Q9ZWJ9	7e-75	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	A0A1J3J449	1e-81	A0A1J3J449_NOCCA; Two-component response regulator ARR2 (Fragment)
STRING	scaffold_702902.1	1e-73	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM15903	7	12

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	9e-58	response regulator 2

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]