PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC6161_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10092.5 Da PI: 9.7481

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC6161_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	65	1.4e-20	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++++G g+W++ +++ g++R++k+c++rw +yl RrC6161_p1 14 KGPWTPEEDQKLINYIRKHGHGSWRALPKEAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-28	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.729	9	65	IPR017930	Myb domain
SMART	SM00717	1.4E-16	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-19	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.9E-26	15	88	IPR009057	Homeodomain-like
CDD	cd00167	3.15E-13	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.7E-10	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.874	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLINYIR KHGHGSWRAL PKEAGLNRCG KSCRLRWTNY 60 LRPDIKRGNF TAEEDQTIIN LHSLLGNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-19	12	88	5	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228268	1e-107	AK228268.1 Arabidopsis thaliana mRNA for MYB family transcription factor like protein, complete cds, clone: RAFL14-72-D06.
GenBank	ATAC018363	1e-107	AC018363.8 Arabidopsis thaliana chromosome III BAC F13E7 genomic sequence, complete sequence.
GenBank	CP002686	1e-107	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018437345.1	5e-59	PREDICTED: transcription factor MYB3-like
Swissprot	Q9S9Z2	4e-53	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A0D3AFX8	3e-57	A0A0D3AFX8_BRAOL; Uncharacterized protein
TrEMBL	A0A178VA47	2e-57	A0A178VA47_ARATH; MYB107
TrEMBL	A0A3P6GB01	3e-57	A0A3P6GB01_BRAOL; Uncharacterized protein
STRING	Bo1g155040.1	5e-58	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G02940.1	3e-61	myb domain protein 107

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]