![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC7194_p2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 114aa MW: 12679.4 Da PI: 11.1423 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 61.1 | 4.5e-19 | 73 | 114 | 2 | 43 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdk 43
g+kdrhsk++T +g+RdRRvRls+++a++++dLq++LG+d+
RrC7194_p2 73 FGGKDRHSKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGLDQ 114
689*************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 2.3E-17 | 75 | 114 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 22.216 | 75 | 114 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MNTVPWRDAN DDVSGGIRTR RDGEVQKNTE EAVVATSGKP VIKKPPTSIS SSSSSSSWMK 60 SKDPRIVRVS RAFGGKDRHS KVCTLRGLRD RRVRLSVPTA IQLYDLQERL GLDQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC232459 | 1e-123 | AC232459.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB020F06, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018489088.1 | 5e-76 | PREDICTED: transcription factor TCP13 | ||||
| Swissprot | Q9S7W5 | 1e-51 | TCP13_ARATH; Transcription factor TCP13 | ||||
| TrEMBL | A0A397ZGA7 | 1e-59 | A0A397ZGA7_BRACM; Uncharacterized protein | ||||
| STRING | Bra039158.1-P | 1e-58 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM9134 | 26 | 37 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02150.1 | 5e-53 | plastid transcription factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




