![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC7363_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 139aa MW: 15882.3 Da PI: 11.5829 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 103.8 | 1.5e-32 | 15 | 71 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF
RrC7363_p1 15 NEPVFVNAKQYQAILRRRQRRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 71
59****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 3.2E-36 | 13 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.675 | 14 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 7.2E-27 | 16 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.9E-23 | 17 | 39 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 19 | 39 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.9E-23 | 48 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MVPSRMLLPH NIPENEPVFV NAKQYQAILR RRQRRAKLEA QNKLIKVRKP YLHESRHLHA 60 LKRARGSGGR FLNTKKLQES KSPPFLATSV KFRQRDILGV VAVGSSGPDL SGNNDDMFQQ 120 ESQLRFSGYP SNHHVSVLM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-20 | 15 | 83 | 2 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 29 | 36 | RRRQRRAK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018463104.1 | 4e-89 | PREDICTED: nuclear transcription factor Y subunit A-6 | ||||
| Refseq | XP_018463105.1 | 4e-89 | PREDICTED: nuclear transcription factor Y subunit A-6 | ||||
| Refseq | XP_018464075.1 | 5e-91 | PREDICTED: nuclear transcription factor Y subunit A-6-like | ||||
| Swissprot | Q9LVJ7 | 2e-67 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
| TrEMBL | A0A3P5ZZV6 | 3e-86 | A0A3P5ZZV6_BRACM; Uncharacterized protein | ||||
| STRING | Bra021527.1-P | 5e-87 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM14733 | 16 | 20 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G14020.1 | 8e-70 | nuclear factor Y, subunit A6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




