PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC7374_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

YABBY

Protein Properties

Length: 75aa MW: 8448.44 Da PI: 7.9633

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC7374_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	76.9	6.3e-24	1	36	135	170
YABBY 135 eeiqrikasnPdishreafsaaaknWahfPkihfgl 170 eeiqrika+nPdishreafsaaaknWahfP+ihfgl RrC7374_p1 1 EEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 36 8*********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.0E-21	1	36	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
EEIQRIKAGN PDISHREAFS AAAKNWAHFP HIHFGLMPDH PPTKKANVRQ QEREEVMMGR 60 EGFYGSAANV GVTHN

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10457020, PubMed:12417699, PubMed:19837869). Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity (PubMed:10457020, PubMed:12417699). {ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009111509.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_009111510.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_009111511.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_009111512.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_013693633.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_013693636.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_013693638.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_013693644.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_013693645.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_013693647.1	1e-48	axial regulator YABBY 3 isoform X1
Refseq	XP_018454384.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_018454385.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_018454386.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X2
Refseq	XP_018454387.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X2
Refseq	XP_018455884.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_018455885.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X1
Refseq	XP_018455886.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X2
Refseq	XP_018455887.1	1e-48	PREDICTED: axial regulator YABBY 3 isoform X2
Swissprot	Q9XFB1	8e-46	YAB3_ARATH; Axial regulator YABBY 3
TrEMBL	A0A078JBF7	3e-47	A0A078JBF7_BRANA; BnaAnng18530D protein
TrEMBL	A0A397XXC6	3e-47	A0A397XXC6_BRACM; Uncharacterized protein
TrEMBL	M4F8A8	3e-47	M4F8A8_BRARP; Uncharacterized protein
STRING	Bra037320.1-P	5e-48	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2217	28	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G00180.2	2e-48	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yadav RK, et al. Plant stem cell maintenance involves direct transcriptional repression of differentiation program. Mol. Syst. Biol., 2013. 9: p. 654 [PMID:23549482]